PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G13620.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 216aa    MW: 24833.4 Da    PI: 8.7266
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G13620.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.18.4e-32959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  OMERI06G13620.4  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                     79***********************************************96 PP

2K-box76.85.8e-267014326100
            K-box  26 keienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                      k+++++++  R+llGedL+sL +keL++Le+qL++slk++R++++++l++q+ elq+ke++++e+n++Lr+klee
  OMERI06G13620.4  70 KQLSKIEK-VRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEE 143
                      34455555.5**************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.389161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
CDDcd002652.36E-40265No hitNo description
SuperFamilySSF554556.15E-31279IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-33323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-333859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.7155147IPR002487Transcription factor, K-box
PfamPF014865.7E-1977141IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCST  60
QRNAVTQDPK QLSKIEKVRN LLGEDLDSLG IKELESLEKQ LDSSLKHVRT TRTKHLVDQL  120
TELQRKEQMV SEANRCLRRK LEESNHVRGQ QVWEQGCNLI AYERQPEVQQ PLHGGNGFFH  180
PLDAAGEPTL QIGYPAEHHE AMNSACMNTY MPPWLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-19265164MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-19265164MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-19265164MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-19265164MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S2e-19165165Myocyte-specific enhancer factor 2B
1tqe_R2e-19165165Myocyte-specific enhancer factor 2B
1tqe_Q2e-19165165Myocyte-specific enhancer factor 2B
1tqe_P2e-19165165Myocyte-specific enhancer factor 2B
3p57_J2e-19265164Myocyte-specific enhancer factor 2A
3p57_I2e-19265164Myocyte-specific enhancer factor 2A
3p57_D2e-19265164Myocyte-specific enhancer factor 2A
3p57_C2e-19265164Myocyte-specific enhancer factor 2A
3p57_B2e-19265164Myocyte-specific enhancer factor 2A
3p57_A2e-19265164Myocyte-specific enhancer factor 2A
3kov_J2e-19265164Myocyte-specific enhancer factor 2A
3kov_I2e-19265164Myocyte-specific enhancer factor 2A
3kov_B2e-19265164Myocyte-specific enhancer factor 2A
3kov_A2e-19265164Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1002630.0AK100263.1 Oryza sativa Japonica Group cDNA clone:J023063L04, full insert sequence.
GenBankAY5519210.0AY551921.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS216 mRNA, complete cds.
GenBankFJ7509340.0FJ750934.1 Oryza sativa clone KCS054B01 MADS-box transcription factor 7 mRNA, complete cds.
GenBankOSU319940.0U31994.1 Oryza sativa MADS box protein OsMADS45 mRNA, complete cds.
GenBankOSU788910.0U78891.2 Oryza sativa MADS box protein (MADS7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648762.11e-142PREDICTED: MADS-box transcription factor 7 isoform X2
SwissprotP0C5B01e-143MADS7_ORYSI; MADS-box transcription factor 7
SwissprotQ0J4661e-143MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBLA0A0E0E0W91e-161A0A0E0E0W9_9ORYZ; Uncharacterized protein
STRINGBGIOSGA029052-PA1e-141(Oryza sativa Indica Group)
STRINGORGLA08G0230000.11e-141(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.14e-66MIKC_MADS family protein